Get this data via API

Classify hayikamacarpetwashingmachine.com — and any other URL — with one call.

620+ IAB categories, company data, tech stacks and logos. JSON out, real time.

curl -X POST 'https://www.klazify.com/api/categorize' \ -H 'Authorization: Bearer YOUR_API_KEY' \ -H 'Content-Type: application/json' \ -d '{"url": "https://hayikamacarpetwashingmachine.com"}'
{ "domain": { "domain_url": "https://hayikamacarpetwashingmachine.com", "categories": [ { "name": "/Home & Garden/Domestic Services/Cleaning Services", "confidence": 0.83, "IAB10": "Home & Garden" }, { "name": "/Home & Garden/Home Improvement/Flooring", "confidence": 0.73, "IAB10": "Home & Garden", "IAB-280-274": "Home Improvement/Home & Garden/Home Improvement" }, { "name": "/Home & Garden/Home Furnishings/Rugs & Carpets", "confidence": 0.65, "IAB10": "Home & Garden" } ] }, "success": true }
Get Free API Key View API Docs