Get this data via API
Classify premiercarpetcleaningftwayne.com — and any other URL — with one call.
620+ IAB categories, company data, tech stacks and logos. JSON out, real time.
curl -X POST 'https://www.klazify.com/api/categorize' \
-H 'Authorization: Bearer YOUR_API_KEY' \
-H 'Content-Type: application/json' \
-d '{"url": "https://premiercarpetcleaningftwayne.com"}'
{
"domain": {
"domain_url": "https://premiercarpetcleaningftwayne.com",
"categories": [
{
"name": "/Home & Garden/Home Improvement/Flooring",
"confidence": 0.98,
"IAB10": "Home & Garden"
},
{
"name": "/Home & Garden/Domestic Services/Cleaning Services",
"confidence": 0.82,
"IAB10": "Home & Garden"
}
]
},
"success": true
}
Category
Get this data as JSON — free trial, 50 API calls included.