Get this data via API
Classify windshieldreplacementmckinney.com — and any other URL — with one call.
620+ IAB categories, company data, tech stacks and logos. JSON out, real time.
curl -X POST 'https://www.klazify.com/api/categorize' \
-H 'Authorization: Bearer YOUR_API_KEY' \
-H 'Content-Type: application/json' \
-d '{"url": "https://windshieldreplacementmckinney.com"}'
{
"domain": {
"domain_url": "https://windshieldreplacementmckinney.com",
"categories": [
{
"name": "/Autos & Vehicles/Vehicle Parts & Services/Vehicle Repair & Maintenance",
"confidence": 0.99,
"IAB-34-1": "Auto Repair/Automotive/Auto Repair"
}
]
},
"success": true
}
Category
Get this data as JSON — free trial, 50 API calls included.